CYP11B1 Rabbit Polyclonal Antibody

SKU: orb584585

Description

Rabbit polyclonal antibody to CYP11B1

Research Area

Product Categories/Antibodies/Primary Antibodies,Product Categories/Antibodies,Root Catalog/Products/Polyclonal Antibodies,Root Catalog/Research Areas/Mitochondria,Root Catalog/Research Areas/Disease Related,Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies,Root Catalog/Products/Polyclonal Antibodies/Enhanced Validation Polyclonal Antibodies,Root Catalog/Products/Primary Antibodies,Root Catalog/Products/Aviva Rabbit Polyclonal

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human, Monkey
• Predicted Reactivity: Porcine, Sheep

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human CYP11B1
• Target: CYP11B1
• Protein Sequence: Synthetic peptide located within the following region: ARNPNVQQALRQESLAAAASISEHPQKATTELPLLRAALKETLRLYPVGL
• Molecular Weight: 58 kDa
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

FHI, CPN1, CYP11B, P450C11

Sample type: 1. HEK293TN-GFP-hcyp11B1 (75 ug), 2. HEK293TN-GFP-hcyp11B2 (75 ug), Primary dilution: 1:100, Secondary Antibody: mouse anti-Rabbit HRP, Secondary dilution: 1:10000, Film Exposed for: 5 minutes.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment.

Sample Tissue: Human HepG2 Whole Cell, Antibody dilution: 1 ug/ml.

Sample Type: Monkey adrenal gland, Primary Antibody dilution: 1:25, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody dilution: 1:1000, Color/Signal Descriptions: Brown: CYP11B1 Blue: Nucleus, Gene Name: CYP11B1.

Sample Type: Monkey vagina, Primary Antibody dilution: 1:25, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody dilution: 1:1000, Color/Signal Descriptions: Brown: CYP11B1 Blue: Nucleus, Gene Name: CYP11B1.

WB Suggested Anti-CYP11B1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Human Liver.

Quick Database Links

Gene Symbol

CYP11B1

UniProt

P15538

RefSeq (Protein):NP_000488