HMGB1 Rabbit Polyclonal Antibody

SKU: orb576530

Description

Rabbit polyclonal antibody to HMGB1

Research Area

Product Categories/Antibodies/Primary Antibodies,Signaling Pathways,Neuroscience,Signaling Pathways/Autophagic,Cancer,Epigenetics,Infectious Diseases,Cancer/DNA Damage,Product Categories/Antibodies,Immunology,Root Catalog/Products/Polyclonal Antibodies,Root Catalog/Products/Polyclonal Antibodies/Transcription Factor,Root Catalog/Products/Polyclonal Antibodies/Cell Cycle Proteins,Root Catalog/Research Areas/Immunology,Root Catalog/Research Areas/Neuroscience,Root Catalog/Research Areas/DNA\/RNA\/Protein Interactions,Root Catalog/Research Areas/DNA Repair,Root Catalog/Research Areas/Transcription Factors,Root Catalog/Research Areas/Cell Differentiation,Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies,Root Catalog/Products/Primary Antibodies,Root Catalog/Products/Aviva Rabbit Polyclonal

Images & Validation

• Tested Applications: WB
• Reactivity: Human, Rat
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HMGB1
• Target: HMGB1
• Protein Sequence: Synthetic peptide located within the following region: GKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKT
• Molecular Weight: 25kDa
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

HMG1, HMG3, HMG-1, SBP-1

Quick Database Links

Gene Symbol

HMGB1

UniProt

P09429

RefSeq (Protein):NP_002119