You have no items in your shopping cart.
Description
Research Area
Images & Validation
−| Tested Applications | IHC, WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human HNRPH3 |
| Target | HNRNPH3 |
| Protein Sequence | Synthetic peptide located within the following region: DYQGRSTGEAFVQFASKEIAENALGKHKERIGHRYIEIFRSSRSEIKGFY |
| Molecular Weight | 38 kDa |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 1.0 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−hnRNP H3 Polyclonal Antibody [orb1418971]
ELISA, ICC, IF, IHC-Fr, IHC-P
Rat
Rabbit
Polyclonal
Unconjugated
100 μlHNRNPH3 Antibody [orb627763]
ELISA, IF, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
100 μg, 50 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

25 ug of the indicated Human cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment. Recommended dilution for this antibody is 1-3 ug/mL. Two closely sized isoforms are observed in some samples, and a smaller isoform is observed in 293T cells.

Rabbit Anti-HNRNPH3 Antibody, Paraffin Embedded Tissue: Human alveolar cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/mL, Magnification: 400X.

Rabbit Anti-HNRPH3 Antibody, Paraffin Embedded Tissue: Human Kidney, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/mL, Magnification: 400X.

WB Suggested Anti-HNRPH3 Antibody Titration: 1.0 ug/mL, ELISA Titer: 1:62500, Positive Control: Raji cell lysate, HNRNPH3 is strongly supported by BioGPS gene expression data to be expressed in Human Raji cells.
Documents Download
Request a Document
Protocol Information
HNRPH3 Rabbit Polyclonal Antibody (orb324892)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review



