Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

NR4A2 Rabbit Polyclonal Antibody

SKU: orb330013

Description

Rabbit polyclonal antibody to NR4A2

Research Area

Product Categories/Antibodies/Primary Antibodies,Product Categories/Antibodies,Root Catalog/Products/Polyclonal Antibodies,Root Catalog/Products/Polyclonal Antibodies/Transcription Factor,Root Catalog/Products/Polyclonal Antibodies/Signal Proteins,Root Catalog/Products/Polyclonal Antibodies/Lymphocyte Signaling,Root Catalog/Products/Polyclonal Antibodies/Membrane Protein,Root Catalog/Research Areas/Developmental Biology,Root Catalog/Research Areas/Immunohistochemistry,Root Catalog/Research Areas/Receptors,Root Catalog/Research Areas/Hypoxia,Root Catalog/Research Areas/Transcription Factors,Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies,Root Catalog/Products/Primary Antibodies,Root Catalog/Products/Aviva Rabbit Polyclonal

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman, Mouse
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human NR4A2
TargetNR4A2
Protein SequenceSynthetic peptide located within the following region: MPCVQAQYGSSPQGASPASQSYSYHSSGEYSSDFLTPEFVKFSMDLTNTE
Molecular Weight66kDa
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti HZF-3 antibody, anti NOT antibody, anti NURR1 antibody, anti RNR1 antibody, anti TINUR antibody

Similar Products

  • Nurr1 Rabbit Polyclonal Antibody [orb11174]

    ELISA,  IF,  IHC-Fr,  IHC-P,  WB

    Mouse, Rat

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    200 μl, 100 μl, 50 μl
  • Nurr1 Rabbit Polyclonal Antibody [orb500721]

    IF,  IHC-Fr,  IHC-P

    Mouse, Rat

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    200 μl, 50 μl, 100 μl
  • (Mouse) Nr4a2 Antibody (Center) [orb1926527]

    IHC-P,  WB

    Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    400 μl
  • (Mouse) Nr4a2 Antibody (Center) [orb306502]

    IHC-P,  WB

    Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    80 μl
  • NR4A2 Rabbit Polyclonal Antibody [orb329685]

    WB

    Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish

    Human

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

NR4A2 Rabbit Polyclonal Antibody

Immunohistochemistry of formalin-fixed, paraffin-embedded human adrenal tissue after heat-induced antigen retrieval. NR4A2 Antibody (orb330013) concentration 5 ug/mL.

NR4A2 Rabbit Polyclonal Antibody

Immunohistochemistry of formalin-fixed, paraffin-embedded human kidney tissue after heat-induced antigen retrieval. NR4A2 Antibody (orb330013) concentration 5 ug/mL.

NR4A2 Rabbit Polyclonal Antibody

Lanes: Lane 1: Nuclear fraction from mouse substantia nigra, Lane 2: Nuclear fraction from mouse substantia nigra, Lane 3: Nuclear fraction from mouse cortex, Lane 4: Nuclear fraction from mouse cortex, Primary Antibody Dilution: 1:400, Secondary Antibody: Goat anti rabbit-HRP, Secondary Antibody Dilution: 1:10000, Gene Name: NR4A2.

NR4A2 Rabbit Polyclonal Antibody

WB Suggested Anti-NR4A2 Antibody Titration: 1 ug/mL, Positive Control: Hela cell lysate.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_006177

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

NR4A2 Rabbit Polyclonal Antibody (orb330013)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 600.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry