OCLN Rabbit Polyclonal Antibody

SKU: orb578638

Description

OCLN is an integral membrane protein which is located at tight junctions. This protein may be involved in the formation and maintenance of the tight junction. The possibility of several alternatively spliced products has been suggested but the full nature of these products has not been described.

Research Area

Product Categories/Antibodies/Primary Antibodies,Epigenetics,Product Categories/Antibodies,Root Catalog/Products/Polyclonal Antibodies,Root Catalog/Products/Polyclonal Antibodies/Transcription Factor,Root Catalog/Products/Polyclonal Antibodies/Signal Proteins,Root Catalog/Research Areas/Chromatin & Nuclear Signaling,Root Catalog/Research Areas/Disease Related,Root Catalog/Research Areas/DNA\/RNA\/Protein Interactions,Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies,Root Catalog/Products/Primary Antibodies,Root Catalog/Products/Aviva Rabbit Polyclonal

Images & Validation

• Tested Applications: WB
• Reactivity: Human, Rat
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human OCLN
• Target: OCLN
• Protein Sequence: Synthetic peptide located within the following region: VRPMLSQPAYSFYPEDEILHFYKWTSPPGVIRILSMLIIVMCIAIFACVA
• Molecular Weight: 59kDa
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

BLCPMG

Quick Database Links

Gene Symbol

OCLN

UniProt

Q16625

RefSeq (Protein):NP_002529