Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

anti-NSP3 (SARS-CoV-2)

SKU: orb1463325

Description

Nsp3 is part of the multifunctional protein replicase polyprotein 1ab that is involved in the transcription and replication of viral RNA. This non-structural protein has been implicated on several mechanisms such as the cleavage located at the N-terminus of the replicase polyprotein and rearrangement of host membrane that leads to creation of cytoplasmic double-membrane vesicles (DMV) necessary for viral replication.

Images & Validation

−
Tested ApplicationsWB
Dilution RangeWB:1:500-1:2,000
ReactivityVirus
Application Notes
The antibody solution should be gently mixed before use.

Key Properties

−
Antibody TypePrimary Antibody
HostGoat
ClonalityPolyclonal
IsotypeIgG
ImmunogenAntigen: Affinity purified recombinant fusion protein using the C-terminal of Nsp3 (residues 1846 to stop) and produced in E. coli.. Antigen Sequence: MEVTGDSCNNYMLTYNKVENMTPRDLGACIDCSARHINAQVAKSHNIALIWNVKDFMSLSEQLRKQIRSAAKKNNLPFKLTCATTRQVVNVVTTKIALKGG
TargetNSP3 (SARS-CoV-2)
ConjugationUnconjugated

Storage & Handling

−
StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesPBS, 20% glycerol and 0.05% sodium azide
Concentration1 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

−
Nsp3 SARS Coronavirus-2 antibody.
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

Available Sizes

Select a size below

100 μg
$ 280.00
Choose Conjugation or Carrier Free Version
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 2-3 weeks
Bulk Enquiry