Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

CKMT2 Peptide - N-terminal region

SKU: orb2002294

Description

CKMT2 Peptide - N-terminal region

Images & Validation

−
Tested ApplicationsWB
Application Notes
This is a synthetic peptide designed for use in combination with CKMT2 Rabbit Polyclonal Antibody (orb327291). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Key Properties

−
MW46kDa
Protein SequenceSynthetic peptide located within the following region: EVREQPRLFPPSADYPDLRKHNNCMAECLTPAIYAKLRNKVTPNGYTLDQ

Storage & Handling

−
StorageAdd 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Form/AppearanceLyophilized powder
Buffer/PreservativesLyophilized powder
Expiration Date6 months from date of receipt.
DisclaimerFor research use only

Alternative Names

−
SMTCK
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

UniProt Details

−
No UniProt data available

NCBI Reference Sequences

−
Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_001816

Protocol Information

Protein Handling and Storage Guide
Protein Handling Guide
View Guide
WB
Western Blot (IB, immunoblot)
View Protocol

Available Sizes

Select a size below

100 μg
$ 230.00
DispatchUsually dispatched within 5-10 working days
Bulk Enquiry