You have no items in your shopping cart.
Featured
Active
Description
Research Area
Product Categories/Products/Proteins,Product Categories/Research Area,Immunology,Epigenetics,Immunology
Images & Validation
−| Application Notes |
|---|
Key Properties
−| Source | Mammalian cell |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | The ED50 as determined in a cell proliferation assay using M‑NFS‑60 mouse myelogenous leukemia lymphoblast cells is less than 4.16 ng/ml. |
| Tag | C-terminal 6xHis-tagged |
| Expression Region | 33-255aa |
| Protein Length | Partial |
| Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
| MW | 26.17 kDa |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Protein Sequence | EEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSSQDVVTKPDCNCLYPKAIPSSDPASVSPHQPLAPSMAPVAGLTWEDSEGTEGSSLLPGEQPLHTVDPGSAKQRPPR |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.2 |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Macrophage Colony-Stimulating Factor 1; CSF-1; M-CSF; MCSF; Lanimostim; CSF1
Similar Products
−Human CSF1 protein (Active) [orb359033]
> 95% as determined by SDS-PAGE and HPLC.
18.4 kDa
E.Coli
10 μg, 100 μg, 500 μgHuman M-CSF (C-6His) Protein [orb1471781]
Greater than 95% as determined by reducing SDS-PAGE.
26.17 KDa
Mammalian
10 μg, 50 μgRecombinant human CSF1R protein, C-His-Avi (HEK293) [orb1516472]
> 95% as determined by Tris-Bis PAGE; > 95% as determined by SEC-HPLC
Due to glycosylation, the protein migrates to 75-105 kDa based on Tris-Bis PAGE result. kDa
100 μgCSF1 purified MaxPab rabbit polyclonal antibody (D01P) [orb2294068]
WB
Human
Rabbit
Polyclonal
Unconjugated
100 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide







