You have no items in your shopping cart.
Featured
Active
Description
Research Area
Product Categories/Products/Proteins,Product Categories/Research Area,Epigenetics,Immunology
Images & Validation
−| Application Notes |
|---|
Key Properties
−| Source | E.Coli |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human peripheral blood neutrophils is in a concentration of 10.0-100.0 ng/ml. |
| Tag | Tag-Free |
| Expression Region | 44-114aa |
| Protein Length | Partial |
| Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
| MW | 7.8 kDa |
| Purity | > 95% as determined by SDS-PAGE and HPLC. |
| Protein Sequence | LRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGGNKEN |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 µm filtered 2 × PBS, pH 7.4 |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−ENA-78, Epithelial-derived neutrophil-activating protein 78, Neutrophil-activating peptide ENA-78, Small-inducible cytokine B5,
Similar Products
−Human CXCL5 protein (Active) [orb359052]
> 97% as determined by SDS-PAGE and HPLC.
8.1 kDa
E.Coli
500 μg, 5 μg, 100 μgRecombinant Human C-X-C motif chemokine 5 protein(CXCL5) (Active) [orb1650758]
20 μg, 500 μg, 5 μg, 100 μg, 1 mg, 250 μgRecombinant Human C-X-C motif chemokine 5 protein(CXCL5) (Active) [orb1650759]
500 μg, 5 μg, 20 μg, 100 μg, 1 mg, 250 μgRecombinantLIX/CXCL5(88aa),Rat [orb1494688]
> 98% as analyzed by SDS-PAGE.
9.6 kDa, observed by reducing SDS-PAGE.
CHO
50 μg, 10 μg, 1 mg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide


