You have no items in your shopping cart.
Description
Research Area
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | E.coli |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Tag | N-terminal GST-tagged |
| Expression Region | 32-216aa |
| Protein Length | Partial |
| Endotoxins | Not test. |
| MW | 47.8 kDa |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Protein Sequence | PHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−Human FGF19 protein (Active) [orb359157]
> 95% as determined by SDS-PAGE and HPLC.
21.8 kDa
E.Coli
5 μg, 100 μg, 500 μgHuman FGF-19 (N-6His) Protein [orb1471725]
Greater than 95% as determined by reducing SDS-PAGE.
23.5 KDa
Mammalian
50 μg, 10 μgHuman FGF19 Protein, His Tag [orb1743271]
The purity of the protein is greater than 85% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 22.3 kDa after removal of the signal peptide. The apparent molecular mass of FGF19-His is approximately 15-25 kDa due to glycosylation.
E.coli
50 μg, 100 μg, 10 μgHuman FGF19 Protein, hFc Tag [orb2321341]
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 47.6 kDa after removal of the signal peptide. The apparent molecular mass of FGF19-hFc is approximately 35-55 kDa due to glycosylation.
Mammalian
10 μg, 100 μg, 50 μgHuman FGF19 protein [orb391726]
ELISA, MS, SDS-PAGE, WB
Greater than 95% as determined by reducing SDS-PAGE.
E. coli
500 μg, 50 μg, 10 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.



