You have no items in your shopping cart.
Featured
Active
Description
Research Area
Product Categories/Products/Proteins,Product Categories/Research Area,Epigenetics,Signal Transduction
Images & Validation
−| Application Notes |
|---|
Key Properties
−| Source | E.Coli |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | Fully biologically active when compared to standard. The ED50 as determined by inducing alkaline phosphatase production of murine ATDC5 cells is less than 1.0 μg/ml, corresponding to a specific activity of > 1000 IU/mg. |
| Tag | Tag-Free |
| Expression Region | 322-450aa |
| Protein Length | Full Length of Mature Protein |
| Endotoxins | Less than 0.1 EU/µg as determined by LAL method. |
| MW | 14.0 kDa |
| Purity | > 95 % as determined by SDS-PAGE and HPLC analyses. |
| Protein Sequence | TALAGTRTAQGSGGGAGRGHGRRGRSRCSRKPLHVDFKELGWDDWIIAPLDYEAYHCEGLCDFPLRSHLEPTNHAIIQTLLNSMAPDAAPASCCVPARLSPISILYIDAANNVVYKQYEDMVVEACGCR |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 µm filtered concentrated solution in 30 % Acetonitrile and 0.1 % TFA. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−GDF-7, BMP12
Similar Products
−Human Growth Differentiation Factor 7 (GDF7) ELISA Kit [orb1948530]
Human
62.5-4000pg/mL
37.5 pg/mL
48 T, 96 THuman GDF7 Protein [orb425678]
Greater than 95.0% as determined by SDS-PAGE.
Escherichia Coli
2 μg, 10 μg, 1 mgRecombinant Human GDF7 [orb1100403]
ELISA, WB
Greater than 95% by SDS-PAGE gel analyses
35 KDa
E.Coli
200 μg, 50 μg, 100 μg, 1 mgHuman GDF7 protein [orb755461]
ELISA, WB
Greater than 95% as determined by SDS-PAGE
14.1 kDa
E.Coli
200 μg, 100 μg, 1 mg, 50 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide


