You have no items in your shopping cart.
Featured
Description
Research Area
Product Categories/Products/Proteins,Product Categories/Research Area,Neuroscience,Signaling Pathways,Product Categories/Products/Proteins/Peptides,Signaling Pathways/GPCR,Epigenetics,Cardiovascular
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | Mammalian cell |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | Measured by its binding ability in a functional ELISA. Immobilized Human GLP1R at 2 μg/mL can bind Anti-GLP1R recombinant antibody, the EC50 is 54.54-94.23 ng/mL. |
| Tag | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
| Expression Region | 24-145aa |
| Protein Length | Partial |
| Endotoxins | Less than 1.0 EU/ug as determined by LAL method. |
| MW | 19.3 kDa |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Protein Sequence | RPQGATVSLWETVQKWREYRRQCQRSLTEDPPPATDLFCNRTFDEYACWPDGEPGSFVNVSCPWYLPWASSVPQGHVYRFCTAEGLWLQKDNSSLPWRDLSECEESKRGERSSPEEQLLFLY |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−(GLP-1 receptor)(GLP-1-R)(GLP-1R)
Similar Products
−- Item 1 of 1
Human Glucagon-like Peptide 1 receptor (GLP1R) ELISA Kit [orb1948005]
Human
0.32-20ng/mL
0.19 ng/mL
96 T, 48 T - Item 1 of 4
Human GLP1R Protein, hFc Tag [orb1743290]
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 39.7 kDa after removal of the signal peptide. The apparent molecular mass of GLP1R-hFc is approximately 35-70 kDa due to glycosylation.
Mammalian
50 μg, 100 μg, 10 μg - Item 1 of 2
Human GLP1R full length protein-synthetic nanodisc [orb1743150]
The human full length GLP1R protein has a MW of 53.0 kDa
Mammalian
10 μg, 50 μg, 100 μg Human GLP-1 protein [orb595165]
Greater than 85% as determined by SDS-PAGE.
53.6 kDa
in vitro E.coli expression system
20 μg, 100 μgHuman GLP1R protein [orb244234]
Greater than 90% as determined by SDS-PAGE.
18.3 kDa
E.coli
20 μg, 100 μg, 1 mg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
Available Sizes
Select a size below
Usually dispatched within 5-10 working days