Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

Human IL17A & IL17F protein

SKU: orb594824

Description

Recombinant Human Interleukin-17A & Interleukin-17F(IL17A & IL17F) (Active)

Research Area

Product Categories/Products/Proteins,Product Categories/Research Area,Epigenetics,Immunology

Images & Validation

Application Notes
Heterodimer

Key Properties

SourceMammalian cell
Biological OriginHomo sapiens (Human)
Biological Activity①Loaded Biotinylated Human IL-17RA -His-Avi on SA Biosensor, can bind Human IL-17A&17F-His with an affinity constant of 8.6 pM as determined in BLI assay. ②Loaded Biotinylated Human IL-17RA-Fc on Pro A Biosensor, can bind Human IL-17A&17F-His with an affinity constant of 10.3 nM as determined in BLI assay.
TagC-terminal 6xHis-tagged
Expression Region24-155aa & 31-163aa
Protein LengthHeterodimer
EndotoxinsLess than 1.0 EU/µg as determined by LAL method.
MW15.1kDa & 16.0 kDa
PurityGreater than 95% as determined by SDS-PAGE.
Protein SequenceGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA &RKIPKVGHTFFQKPESCPPVPGGSMKLDIGIINENQRVSMSRNIESRSTSPWNYTVTWDPNRYPSEVVQAQCRNLGCINAQGKEDISMNSVPIQQETLVVRRKHQGCSVSFQLEKVLVTVGCTCVTPVIHRVQ

Storage & Handling

StorageThe shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Form/AppearanceLyophilized powder
Buffer/PreservativesLyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4
Expiration Date6 months from date of receipt.
DisclaimerFor research use only

Alternative Names

IL‑17A/F Heterodimer;IL-17A&IL-17F Heterodimer
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

UniProt Details

No UniProt data available

Protocol Information

Protein Handling and Storage Guide
Protein Handling Guide
View Guide

Available Sizes

Select a size below

10 μg
$ 340.00
50 μg
$ 850.00
500 μg
$ 2,780.00
1 mg
$ 4,300.00
DispatchUsually dispatched within 1-2 weeks
Bulk Enquiry