You have no items in your shopping cart.
Featured
Active
Description
Research Area
Product Categories/Products/Proteins,Product Categories/Research Area,Immunology,Immunology
Images & Validation
−| Application Notes |
|---|
Key Properties
−| Source | E.coli |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | The ED50 as determined by its ability to induce IL-8 secretion in A431 human epithelial carcinoma cells is 5-20 ng/ml. |
| Tag | Tag-Free |
| Expression Region | 18-169aa |
| Protein Length | Full Length of Mature Protein |
| Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
| MW | 17 kDa |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Protein Sequence | SMCKPITGTINDLNQQVWTLQGQNLVAVPRSDSVTPVTVAVITCKYPEALEQGRGDPIYLGIQNPEMCLYCEKVGEQPTLQLKEQKIMDLYGQPEPVKPFLFYRAKTGRTSTLESVAFPDWFIASSKRDQPIILTSELGKSYNTAFELNIND |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 100 mM NaCl, 0.1 mM EDTA, pH 8.0 |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Interleukin-36 gamma; IL36G; IL-1-related protein 2; IL-1RP2; IL-1 epsilon; IL-1F9; Interleukin-1 homolog 1; IL-1H1
Similar Products
−Human Interleukin 1 Family, Member 9 (IL1F9) ELISA Kit [orb779986]
Human
15.63-1000 pg/mL
6 pg/mL
48 T, 96 THuman IL36G protein (Active) [orb358994]
> 95% as determined by SDS-PAGE and HPLC.
18.7 kDa
E.Coli
100 μg, 500 μg, 10 μgHuman IL36G protein (Active) [orb358995]
> 95% as determined by SDS-PAGE and HPLC.
17.0 kDa
E.Coli
10 μg, 100 μg, 500 μgHuman IL36G Protein, hFc Tag [orb2321300]
The purity of the protein is greater than 90% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 43.2 kDa after removal of the signal peptide.
Mammalian
10 μg, 50 μg, 100 μgHuman IL1F9(Interleukin 1 Family, Member 9) Microsample ELISA Kit [orb2997975]
15.63-1000 pg/mL
6 pg/mL
96 T, 48 T

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide





