Human SSTR2-VLPs Protein

SKU: orb1478128

Description

Recombinant Human Somatostatin receptor type 2(SSTR2)-VLPs (Active)

Research Area

Product Categories/Products/Proteins,Product Categories/Research Area,Neuroscience,Signaling Pathways,Signaling Pathways/GPCR,Epigenetics,Cancer

Images & Validation

• Application Notes:
  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80℃. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing.

Key Properties

• Source: Mammalian cell
• Biological Origin: Homo sapiens (Human)
• Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized Human SSTR2 at 10 μg/ml can bind Anti-SSTR2 recombinant antibody, the EC50 is 58.13-81.28 ng/mL.
• Tag: C-terminal 6xHis-tagged (This tag can be tested only under denaturing conditions)
• Expression Region: 1-369aa
• Protein Length: Full Length
• Endotoxins: Less than 1.0 EU/ug as determined by LAL method.
• MW: 42.5 kDa
• Protein Sequence: MDMADEPLNGSHTWLSIPFDLNGSVVSTNTSNQTEPYYDLTSNAVLTFIYFVVCIIGLCGNTLVIYVILRYAKMKTITNIYILNLAIADELFMLGLPFLAMQVALVHWPFGKAICRVVMTVDGINQFTSIFCLTVMSIDRYLAVVHPIKSAKWRRPRTAKMITMAVWGVSLLVILPIMIYAGLRSNQWGRSSCTINWPGESGAWYTGFIIYTFILGFLVPLTIICLCYLFIIIKVKSSGIRVGSSKRKKSEKKVTRMVSIVVAVFIFCWLPFYIFNVSSVSMAISPTPALKGMFDFVVVLTYANSCANPILYAFLSDNFKKSFQNVLCLVKVSGTDDGERSDSKQDKSRLNETTETQRTLLNGDLQTSI

Storage & Handling

• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Form/Appearance: Lyophilized powder
• Buffer/Preservatives: Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
• Expiration Date: 6 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

SSTR2, Somatostatin receptor type 2, SS-2-R, SS2-R, SS2R, SRIF-1

Quick Database Links

UniProt

P30874