You have no items in your shopping cart.
Featured
Active
Description
Research Area
Product Categories/Products/Proteins,Product Categories/Research Area,Neuroscience,Signaling Pathways,Signaling Pathways/NF-kB,Epigenetics,Cancer
Images & Validation
−| Application Notes |
|---|
Key Properties
−| Source | E.Coli |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | Fully biologically active when compared to standard. The ED50 as determined by a cytotoxicity assay using murine L929 cells is less than 0.01 ng/ml, corresponding to a specific activity of > 1.0 × 10^7 IU/mg in the presence of actinomycin D. |
| Tag | Tag-Free |
| Expression Region | 87-233aa |
| Protein Length | Partial |
| Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
| MW | 16.9 kDa |
| Purity | > 98% as determined by SDS-PAGE and HPLC. |
| Protein Sequence | MRKR+KPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAF |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered PBS, pH 7.0 |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Cachectin, Tumor necrosis factor ligand superfamily member 2, TNF-a, , NTF
Similar Products
−Human TNF protein [orb594840]
Greater than 95% as determined by SDS-PAGE.
17.5 kDa
E.coli
500 μg, 1 mg, 50 μg, 10 μgHuman TNF protein [orb594841]
Greater than 95% as determined by SDS-PAGE.
18.5 kDa
E.coli
50 μg, 500 μg, 1 mg, 10 μgHuman TNF protein [orb594842]
Greater than 95% as determined by SDS-PAGE.
21.8 kDa
E.coli
1 mg, 500 μg, 10 μg, 50 μgHuman TNFA protein (Active) [orb359192]
> 97% as determined by SDS-PAGE and HPLC.
18.3 kDa
E.Coli
10 μg, 100 μg, 500 μgHuman TNFA protein (Active) [orb359194]
> 98% as determined by SDS-PAGE and HPLC.
17.5 kDa
E.Coli
10 μg, 100 μg, 500 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide





