Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

Human TNFA protein (Active)

SKU: orb359193
ActiveBiologically Active

Description

Recombinant human TNFA active protein

Research Area

Product Categories/Products/Proteins,Product Categories/Research Area,Neuroscience,Signaling Pathways,Signaling Pathways/NF-kB,Epigenetics,Cancer

Images & Validation

Application Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Key Properties

SourceE.Coli
Biological OriginHomo sapiens (Human)
Biological ActivityFully biologically active when compared to standard. The ED50 as determined by a cytotoxicity assay using murine L929 cells is less than 0.01 ng/ml, corresponding to a specific activity of > 1.0 × 10^7 IU/mg in the presence of actinomycin D.
TagTag-Free
Expression Region87-233aa
Protein LengthPartial
EndotoxinsLess than 1.0 EU/µg as determined by LAL method.
MW16.9 kDa
Purity> 98% as determined by SDS-PAGE and HPLC.
Protein SequenceMRKR+KPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAF

Storage & Handling

StorageThe shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Form/AppearanceLyophilized powder
Buffer/PreservativesLyophilized from a 0.2 μm filtered PBS, pH 7.0
Expiration Date6 months from date of receipt.
DisclaimerFor research use only

Alternative Names

Cachectin, Tumor necrosis factor ligand superfamily member 2, TNF-a, , NTF

Similar Products

  • Human TNF protein [orb594840]

    Greater than 95% as determined by SDS-PAGE.

    17.5 kDa

    E.coli

    500 μg, 1 mg, 50 μg, 10 μg
  • Human TNF protein [orb594841]

    Greater than 95% as determined by SDS-PAGE.

    18.5 kDa

    E.coli

    50 μg, 500 μg, 1 mg, 10 μg
  • Human TNF protein [orb594842]

    Greater than 95% as determined by SDS-PAGE.

    21.8 kDa

    E.coli

    1 mg, 500 μg, 10 μg, 50 μg
  • Human TNFA protein (Active) [orb359192]

    > 97% as determined by SDS-PAGE and HPLC.

    18.3 kDa

    E.Coli

    10 μg, 100 μg, 500 μg
  • Human TNFA protein (Active) [orb359194]

    > 98% as determined by SDS-PAGE and HPLC.

    17.5 kDa

    E.Coli

    10 μg, 100 μg, 500 μg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

UniProt Details

No UniProt data available

Protocol Information

Protein Handling and Storage Guide
Protein Handling Guide
View Guide

Available Sizes

Select a size below

10 μg
$ 210.00
100 μg
$ 610.00
500 μg
$ 1,270.00
DispatchUsually dispatched within 1-2 weeks
Bulk Enquiry