You have no items in your shopping cart.
Description
Research Area
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | E.coli |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Tag | N-terminal 6xHis-SUMO-tagged |
| Expression Region | 43-249aa |
| Protein Length | Extracellular Domain |
| Endotoxins | Not test. |
| MW | 38.9 kDa |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Protein Sequence | SLGSRASLSAQEPAQEELVAEEDQDPSELNPQTEESQDPAPFLNRLVRPRRSAPKGRKTRARRAIAAHYEVHPRPGQDGAQAGVDGTVSGWEEARINSSSPLRYNRQIGEFIVTRAGLYYLYCQVHFDEGKAVYLKLDLLVDGVLALRCLEEFSATAASSLGPQLRLCQVSGLLALRPGSSLRIRTLPWAHLKAAPFLTYFGLFQVH |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−Human TNFSF12 Protein, hFc Tag [orb757421]
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 43.3 kDa after removal of the signal peptide.
Mammalian
50 μg, 10 μg, 100 μgHuman sTWEAK ELISA Kit [orb339721]
Human
0.312 ng/ml-20 ng/ml
0.078 ng/ml
10 x 96 T, 48 T, 24 T, 5 x 96 T, 96 TRecombinantTWEAK,Human [orb1494661]
> 95% as analyzed by SDS-PAGE and HPLC.
20-22 kDa, observed by reducing SDS-PAGE.
CHO
50 μg, 10 μg, 1 mgHuman TNFSF12 Protein [orb428921]
Greater than 95% as determined by SDS-PAGE.
Escherichia coli
1 mg, 5 μg, 25 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.



