You have no items in your shopping cart.
Description
Research Area
Images & Validation
−| Application Notes |
|---|
Key Properties
−| Source | Mammalian cell |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | Measured by its binding ability in a functional ELISA. Immobilized TNFRSF18 at 2 μg/ml can bind TNFSF18 , the EC50 is 2.565 to 2.940 ng/ml. Human TNFRSF18 protein hFc tag captured on COOH chip can bind Human TNFSF18 protein hFc and Flag tag with an affinity constant of 38.5 nM as detected by LSPR Assay. |
| Tag | N-terminal hFc-Flag-tagged |
| Expression Region | 72-199aa |
| Protein Length | Partial |
| Endotoxins | Less than 1.0 EU/ug as determined by LAL method. |
| MW | 42.8 kDa |
| Purity | Greater than 94% as determined by SDS-PAGE. |
| Protein Sequence | QLETAKEPCMAKFGPLPSKWQMASSEPPCVNKVSDWKLEILQNGLYLIYGQVAPNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQNVGGTYELHVGDTIDLIFNSEHQVLKNNTYWGIILLANPQFIS |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4 |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Similar Products
−Human Activation-inducible TNF-related Ligand (AITRL/TNFSF18) ELISA Kit [orb1947840]
Human
0.16-10ng/mL
0.1 ng/mL
48 T, 96 THuman GITR Ligand Protein, His tag [orb689462]
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 15.3 kDa after removal of the signal peptide.
Mammalian
10 μg, 50 μg, 100 μgHuman GITR Ligand Protein, mFc-His tag [orb689381]
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 46-53 kDa after removal of the signal peptide.
Mammalian
100 μg, 10 μg, 50 μgMouse GITR Ligand Protein, hFc Tag [orb1290852]
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 40.6 kDa after removal of the signal peptide. The apparent molecular mass of hFc-mGITRL is approximately 40-55 kDa due to glycosylation.
Mammalian
10 μg, 50 μg, 100 μgHuman TNFSF18 ELISA Kit [orb405481]
Human
Request Information
Request Information
5 x 96 T, 10 x 96 T, 96 T, 48 T, 24 T

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.











