Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

IL19 Peptide - C-terminal region

SKU: orb2004715

Description

IL19 Peptide - C-terminal region

Images & Validation

Tested ApplicationsWB
Application Notes
This is a synthetic peptide designed for use in combination with IL19 Rabbit Polyclonal Antibody (orb585852). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Key Properties

MW23kDa
Protein SequenceSynthetic peptide located within the following region: KILRKISSIANSFLYMQKTLRQCQEQRQCHCRQEATNATRVIHDNYDQLE

Storage & Handling

StorageAdd 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Form/AppearanceLyophilized powder
Buffer/PreservativesLyophilized powder
Expiration Date6 months from date of receipt.
DisclaimerFor research use only

Alternative Names

IL-10C, MDA1, NG.1, ZMDA1
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_715639

Protocol Information

Protein Handling and Storage Guide
Protein Handling Guide
View Guide
WB
Western Blot (IB, immunoblot)
View Protocol

Available Sizes

Select a size below

100 μg
$ 230.00
DispatchUsually dispatched within 5-10 working days
Bulk Enquiry