You have no items in your shopping cart.
Description
Research Area
Product Categories/Products/Proteins,Product Categories/Products/Proteins/Peptides,Antibacterials,Antivirals
Images & Validation
−Key Properties
−| CAS Number | 154947-66-7 |
|---|---|
| MW | 4493.3 Da |
| Purity | > 95% by HPLC |
| Formula | C205H340N60O53 |
| Protein Sequence | [LL-37, 37 aa] |
Storage & Handling
−| Storage | Store dry, dark and frozen |
|---|---|
| Form/Appearance | Freeze dried solid |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Ropocamptide, hCAP 18, Cathelicidin, LL 37, LL-37, cathelicidin, LL 37 (human)
Similar Products
−Human Antibacterial Protein LL-37 (LL-37) ELISA Kit [orb782025]
Human
0.79-50 ng/mL
0.28 ng/mL
96 T, 48 THuman Antibacterial Protein LL-37 (LL-37) ELISA Kit [orb1807372]
Human
1.56-100ng/mL
0.59 ng/mL
48 T, 96 T, 24 THuman LL-37(Antibacterial Protein LL-37) Microsample ELISA Kit [orb2997509]
0.79-50 ng/mL
0.28 ng/mL
96 T, 48 TLL 37 (18-37) (human) [orb1140561]
> 95% by HPLC
2468.9 Da
H-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH
1 mgHuman Antibacterial Peptide LL-37 ELISA Kit [orb406607]
Human
0.156 ng/mL-10 ng/mL
0.039 ng/mL
10 x 96 T, 5 x 96 T, 48 T, 96 T, 24 T

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide




