You have no items in your shopping cart.
Description
Research Area
Images & Validation
−| Application Notes |
|---|
Key Properties
−| Source | E.Coli |
|---|---|
| Biological Origin | Macaca mulatta (Rhesus macaque) |
| Biological Activity | Fully biologically active when compared to standard. The ED50 as determined by an anti-viral assay using human HeLa cells infected with encephalomyocarditis (EMC) virus is less than 20.0 ng/ml, corresponding to a specific activity of > 5.0 ×104 IU/mg. |
| Tag | Tag-Free |
| Expression Region | 24-165aa |
| Protein Length | Full Length of Mature Protein |
| Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
| MW | 16.8 kDa |
| Purity | > 97% as determined by SDS-PAGE and HPLC. |
| Protein Sequence | QDPYVKEAENLKKYFNAGDPDVADNGTLFLDILRNWKEESDRKIMQSQIVSFYFKLFKNFKDDQRIQKSVETIKEDINVKFFNSNKKKRDDFEKLTNYSVTDSNVQRKAVHELIQVMAELSPAAKIGKRKRSQMFRGRRASQ |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 µm filtered PBS, pH 7.4 |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−Recombinant Rat Interferon-γ (rRtFN-γ) [orb1495057]
> 95% by SDS-PAGE and HPLC analyses.
Approximately 15.6 kDa, a single non-glycosylated polypeptide chain containing 135 amino acids.
Escherichia coli.
1 mg, 100 μg, 20 μgRecombinant Murine Interferon-γ (rMuIFN-γ) [orb1495059]
> 95% by SDS-PAGE and HPLC analyses
Approximately 15.6 kDa, a single non-glycosylated polypeptide chain containing 134 amino acids.
Escherichia coli.
1 mg, 100 μg, 20 μgRecombinant Human Interferon-γ (rHuIFN-γ) [orb1495064]
> 98% by SDS-PAGE and HPLC analyses.
Approximately 17 kDa, a single non-glycosylated polypeptide chain containing 144 amino acids.
Escherichia coli
1 mg, 100 μg, 20 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

