You have no items in your shopping cart.
Recombinant Bovine Fibroblast growth factor 2 (FGF2) (Active)
SKU: orb2657926
Featured
Description
Research Area
,Others
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | E coli |
|---|---|
| Biological Origin | Bos taurus (Bovine) |
| Biological Activity | Measured in a cell proliferation assay using NIH3T3 mouse embryonic fibroblast cells. The ED50 for this effect is ≤2.0 ng/mL. |
| Tag | C-terminal 6xHis-tagged |
| Expression Region | 10-155aa |
| Protein Length | Full Length of Mature Protein |
| Endotoxins | ≤100 EU/mg by the LAL method |
| MW | 17.4 kDa |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Protein Sequence | PALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGPKTGPGQKAILFLPMSAKS |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered solution containing 10mM Tris,200mMNacl, 5% mannitol, pH 8.0. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Fibroblast Growth Factor 2; FGF-2; Basic Fibroblast Growth Factor; bFGF; Heparin-Binding Growth Factor 2; HBGF-2; FGF2; FGFB
Similar Products
−Recombinant Bovine Fibroblast growth factor 2 (FGF2) (Active) [orb2657927]
Greater than 95% as determined by SDS-PAGE.
16.5 kDa
E coli
50 μg, 1 mg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide