You have no items in your shopping cart.
Description
Research Area
Product Categories/Antibodies/Primary Antibodies,Epigenetics,Product Categories/Antibodies,Root Catalog/Products/Polyclonal Antibodies,Root Catalog/Products/Polyclonal Antibodies/Transcription Factor,Root Catalog/Products/Polyclonal Antibodies/Transcription Regulation,Root Catalog/Research Areas/Cell Biology,Root Catalog/Research Areas/Developmental Biology,Root Catalog/Research Areas/Epigenetics,Root Catalog/Research Areas/DNA\/RNA\/Protein Interactions,Root Catalog/Research Areas/Meiosis\/Mitosis\/Cell Cycle,Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies,Root Catalog/Products/Primary Antibodies,Root Catalog/Products/Aviva Rabbit Polyclonal
Images & Validation
−| Tested Applications | WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Target | SFTPA2 |
| Protein Sequence | Synthetic peptide located within the following region: PGNNGLPGAPGVPGERGEKGEAGERGPPGLPAHLDEELQATLHDFRHQIL |
| Molecular Weight | 26kDa |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−anti COLEC5 antibody, anti FLJ50594 antibody, anti FLJ50597 antibody, anti FLJ51953 antibody, anti FLJ79091 antibody, anti FLJ93678 antibody, anti MGC133169 antibody, anti MGC133366 antibody, anti MGC189714 antibody, anti MGC189761 antibody, anti PSAP antibody, anti SFTP1 antibody, anti SFTPA2B antibody, anti SPA2 antibody, anti SPAII antibody
Similar Products
−SFTPA1 Rabbit Polyclonal Antibody [orb11402]
IF, IHC-Fr, IHC-P
Mouse, Rat
Human
Rabbit
Polyclonal
Unconjugated
100 μl, 200 μl, 50 μlAnti-SFTPA1/2 Antibody [orb215430]
IH, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
200 μl, 100 μl, 30 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.
Quick Database Links
UniProt Details
− No UniProt data available
NCBI Reference Sequences
−Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product| Protein | NP_001092138 |
|---|













