You have no items in your shopping cart.
Description
Research Area
Product Categories/Products/Proteins,Product Categories/Products/Proteins/Peptides,Protein-protein interactions,Antivirals
Images & Validation
−
Key Properties
−| CAS Number | 1423821-88-8 |
|---|---|
| MW | 3741.15 Da |
| Purity | > 95% by hplc |
| Formula | C164H251N57O45 |
| Protein Sequence | YGRKKRRQRRRGGTNVFNATFEIWHDGEFGT |
Storage & Handling
−| Storage | Store dry, frozen and in the dark |
|---|---|
| Form/Appearance | Freeze dried solid |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−1423821-88-8, Beclin-1 Activator ITat-BECN1, Tat-Beclin 1, YGRKKRRQRRRGGTNVFNATFEIWHDGEFGT, beclin 1 peptide
Similar Products
−
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
