Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

RIPK3 Rabbit Polyclonal Antibody

SKU: orb573829

Description

Rabbit polyclonal antibody to RIPK3

Research Area

Product Categories/Antibodies/Primary Antibodies,Signaling Pathways,Cancer,Epigenetics,Signaling Pathways/Apoptotic,Neuroscience,Product Categories/Antibodies,Root Catalog/Products/Polyclonal Antibodies,Root Catalog/Products/Polyclonal Antibodies/Transcription Factor,Root Catalog/Research Areas/Chromatin & Nuclear Signaling,Root Catalog/Research Areas/Signal Transduction,Root Catalog/Research Areas/Apoptosis,Root Catalog/Research Areas/Immunohistochemistry,Root Catalog/Research Areas/Receptors,Root Catalog/Research Areas/Phosphorylation,Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies,Root Catalog/Products/Polyclonal Antibodies/Enhanced Validation Polyclonal Antibodies,Root Catalog/Products/Primary Antibodies,Root Catalog/Products/Aviva Rabbit Polyclonal

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Mouse, Porcine, Rat

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human RIPK3
TargetRIPK3
Protein SequenceSynthetic peptide located within the following region: GGSQSGTGSGEPGGTLGYLAPELFVNVNRKASTASDVYSFGILMWAVLAG
Molecular Weight57 kDa
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration1.0 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

RIP3

Similar Products

  • RIPK3 Rabbit Polyclonal Antibody [orb6881]

    IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Guinea pig, Porcine, Rabbit

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • RIPK3 Antibody (Center) [orb1929500]

    IHC-P,  WB

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    400 μl
  • RIPK3 Antibody (Center) [orb652211]

    IHC-P,  WB

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    80 μl
  • RIPK3 Rabbit Polyclonal Antibody [orb592648]

    IHC,  WB

    Canine, Equine

    Human, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • RIPK3 Antibody (C-term) [orb1428417]

    IHC-P,  WB

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    80 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

RIPK3 Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment.

RIPK3 Rabbit Polyclonal Antibody

Sample Type: Lane 1: Transient overexpression lysate of RIPK3, Lane 2: Non-overexpressed vector control lysate, Antibody dilution: 1.0 ug/ml.

RIPK3 Rabbit Polyclonal Antibody

Positive control (+): THP-1 (N30), Negative control (-): A549 (N03), Antibody concentration: 1 ug/ml.

RIPK3 Rabbit Polyclonal Antibody

Human Heart

RIPK3 Rabbit Polyclonal Antibody

Human Liver

RIPK3 Rabbit Polyclonal Antibody

RIPK3 antibody - N-terminal region (orb573829), Catalog Number: orb573829, Formalin Fixed Paraffin Embedded Tissue: Human Pancreas Tissue, Observed Staining: Cytoplasmic in endocrine part (islets) of the pancreas. No staining observed in exocrine cells, Primary Antibody Concentration: 3 -12 ug/ml, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure: 0.2 seconds.

RIPK3 Rabbit Polyclonal Antibody

WB Suggested Anti-RIPK3 antibody Titration: 1 ug/ml, Sample Type: Human HepG2.

RIPK3 Rabbit Polyclonal Antibody

WB Suggested Anti-RIPK3 antibody Titration: 1 ug/ml, Sample Type: Human Jurkat.

RIPK3 Rabbit Polyclonal Antibody

WB Suggested Anti-RIPK3 Antibody Titration: 1.25 ug/ml, ELISA Titer: 1:62500, Positive Control: Jurkat cell lysate.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_006862

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

RIPK3 Rabbit Polyclonal Antibody (orb573829)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 540.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry