Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

THRB Rabbit Polyclonal Antibody

SKU: orb329953

Description

Rabbit polyclonal antibody to THRB

Research Area

Product Categories/Antibodies/Primary Antibodies,Product Categories/Antibodies,Root Catalog/Products/Polyclonal Antibodies,Root Catalog/Products/Polyclonal Antibodies/Transcription Factor,Root Catalog/Products/Polyclonal Antibodies/Transcription Regulation,Root Catalog/Research Areas/Chromatin & Nuclear Signaling,Root Catalog/Research Areas/Disease Related,Root Catalog/Research Areas/Receptors,Root Catalog/Research Areas/Transcription Factors,Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies,Root Catalog/Products/Primary Antibodies,Root Catalog/Products/Aviva Rabbit Polyclonal

Images & Validation

Tested ApplicationsWB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Sheep, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human THRB
TargetTHRB
Protein SequenceSynthetic peptide located within the following region: YQDSFLLAFEHYINYRKHHVTHFWPKLLMKVTDLRMIGACHASRFLHMKV
Molecular Weight53kDa
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti ERBA-BETA antibody, anti ERBA2 antibody, anti GRTH antibody, anti MGC126109 antibody, anti MGC126110 antibody, anti NR1A2 antibody, anti THR1 antibody, anti THRB1 antibody, anti THRB2 antibody, anti PRTH antibody, anti C-ERBA-2 antibody, anti C-ERBA-BETA antibody

Similar Products

  • THRB1 Rabbit Polyclonal Antibody [orb158598]

    FC,  IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Gallus, Rabbit, Sheep

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • THRB Rabbit Polyclonal Antibody [orb1291533]

    ELISA,  FC,  IF,  IHC-Fr,  IHC-P

    Human

    Rabbit

    Polyclonal

    Unconjugated

    100 μl, 200 μl, 50 μl
  • F2 Rabbit Polyclonal Antibody [orb10521]

    FC,  IF,  IHC-Fr,  IHC-P,  WB

    Mouse, Rat

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • THRB1 Rabbit Polyclonal Antibody (BF647) [orb1587020]

    FC,  IF

    Bovine, Gallus, Rabbit, Sheep

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    BF647

    100 μl
  • Anti-THRB Antibody [orb214670]

    IH,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    30 μl, 100 μl, 200 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

THRB Rabbit Polyclonal Antibody

Sample Type: 721_B, Antibody Dilution: 1.0 ug/mL, THRB is supported by BioGPS gene expression data to be expressed in 721_B.

THRB Rabbit Polyclonal Antibody

WB Suggested Anti-THRB Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:1562500, Positive Control: MCF7 cell lysate.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_000452

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

THRB Rabbit Polyclonal Antibody (orb329953)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 600.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry