5HT2A Receptor Antibody

SKU: orb1177025

Description

Rabbit polyclonal antibody to HTR2A

Research Area

,Product Categories/Antibodies

Images & Validation

• Tested Applications: WB
• Dilution Range: Western blot: 0.1-0.5μg/ml
• Reactivity: Human, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human 5HT2A Receptor (400-431aa KENKKPLQLILVNTIPALAYKSSQLQMGQKKN) , different from the related mouse sequence by three amino acids, and from the related rat sequence by two amino acids.
• Target: HTR2A
• Conjugation: Unconjugated

Storage & Handling

• Storage: At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing
• Form/Appearance: Lyophilized
• Buffer/Preservatives: Antibody is lyophilized with 5 mg rAlbumin, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

5 HT 2 antibody, 5 HT 2A antibody, 5 HT2 receptor antibody, 5 HT2A antibody, 5 hydroxytryptamine receptor 2A antibody, 5-HT-2 antibody, 5-HT-2A antibody, 5-hydroxytryptamine (serotonin) receptor 2A, G protein-coupled antibody, 5-hydroxytryptamine 2A receptor antibody, 5-hydroxytryptamine receptor 2A antibody, 5HT2A_HUMAN antibody, HTR 2 antibody, HTR 2A antibody, HTR2 antibody, HTR2, formerly antibody, HTR2A antibody, serotonin 5-HT-2 receptor, formerly antibody, serotonin 5-HT-2A receptor antibody, Serotonin receptor 2A antibody

Quick Database Links

Gene Symbol

HTR2A