Abrin-a Protein, Abrus precatorius, Recombinant (Yeast, His)

SKU: orb1979897

Description

The A chain is responsible for inhibiting protein synthesis through the catalytic inactivation of 60S ribosomal subunits by removing adenine from position 4,324 of 28S rRNA. Abrin-a is more toxic than ricin.; The B chain is a galactose-specific lectin that facilitates the binding of abrin to the cell membrane that precedes endocytosis. Abrin-a Protein, Abrus precatorius, Recombinant (Yeast, His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 30.1 kDa and the accession number is P11140.

Research Area

,Recombinant-Protein

Images & Validation

• Application Notes:
  A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.

Key Properties

• Expression System: P. pastoris (Yeast)
• Biological Origin: Abrus precatorius
• Biological Activity: The A chain is responsible for inhibiting protein synthesis through the catalytic inactivation of 60S ribosomal subunits by removing adenine from position 4,324 of 28S rRNA. Abrin-a is more toxic than ricin.; The B chain is a galactose-specific lectin that facilitates the binding of abrin to the cell membrane that precedes endocytosis. Abrin-a Protein, Abrus precatorius, Recombinant (Yeast, His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 30.1 kDa and the accession number is P11140.
• Tag: N-6xHis
• Expression Region: 1-251 aa
• MW: 30.1 kDa (predicted)
• Purity: 98.00%
• Protein Sequence: QDRPIKFSTEGATSQSYKQFIEALRERLRGGLIHDIPVLPDPTTLQERNRYITVELSNSDTESIEVGIDVTNAYVVAYRAGTQSYFLRDAPSSASDYLFTGTDQHSLPFYGTYGDLERWAHQSRQQIPLGLQALTHGISFFRSGGNDNEEKARTLIVIIQMVAEAARFRYISNRVRVSIQTGTAFQPDAAMISLENNWDNLSRGVQESVQDTFPNQVTLTNIRNEPVIVDSLSHPTVAVLALMLFVCNPPN

Storage & Handling

• Storage: -20°C
• Expiration Date: 6 months from date of receipt.
• Disclaimer: For research use only

Quick Database Links

UniProt

P11140