ACAA1 monoclonal antibody (M01), clone 3F11

SKU: orb2296500

Description

Mouse monoclonal antibody raised against a partial recombinant ACAA1.

Images & Validation

• Tested Applications: ELISA, IF, IHC-P, WB
• Reactivity: Human, Rat

Key Properties

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a Kappa
• Clone No.: 3F11
• Immunogen: ACAA1 (NP_001598, 217 a.a. ~ 315 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: GCFQAEIVPVTTTVHDDKGTKRSITVTQDEGIRPSTTMEGLAKLKPAFKKDGSTTAGNSSQVSDGAAAILLARRSKAEELGLPILGVLRSYAVVGVPPD
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

ACAA1 monoclonal antibody (M01), clone 3F11. Western Blot analysis of ACAA1 expression in human liver.

ACAA1 monoclonal antibody (M01), clone 3F11. Western Blot analysis of ACAA1 expression in PC-12.

ACAA1 monoclonal antibody (M01), clone 3F11. Western Blot analysis of ACAA1 expression in A-431.

Western Blot analysis of ACAA1 expression in transfected 293T cell line by ACAA1 monoclonal antibody (M01), clone 3F11. Lane 1: ACAA1 transfected lysate (Predicted MW: 44.3 KDa). Lane 2: Non-transfected lysate.

Immunoperoxidase of monoclonal antibody to ACAA1 on formalin-fixed paraffin-embedded human liver. [antibody concentration 3 ug/ml]

Detection limit for recombinant GST tagged ACAA1 is 0.1 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to ACAA1 on HeLa cell. [antibody concentration 10 ug/ml]

Western Blot detection against Immunogen (36.63 KDa).

Quick Database Links

RefSeq (Protein):NP_001598