You have no items in your shopping cart.
Description
Images & Validation
−| Tested Applications | ELISA, WB |
|---|---|
| Reactivity | Human, Mouse, Rat |
Key Properties
−| Host | Mouse |
|---|---|
| Clonality | Monoclonal |
| Isotype | IgG2a Kappa |
| Clone No. | 4D10 |
| Immunogen | ACTN4 (NP_004915, 592 a.a. ~ 701 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Protein Sequence | KEAQRIAESNHIKLSGSNPYTTVTPQIINSKWEKVQQLVPKRDHALLEEQSKQQSNEHLRRQFASQANVVGPWIQTKMEEIGRISIEMNGTLEDQLSHLKQYERSIVDYK |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | In ascites fluid |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

ACTN4 monoclonal antibody (M01A), clone 4D10. Western Blot analysis of ACTN4 expression in PC-12.

ACTN4 monoclonal antibody (M01A), clone 4D10. Western Blot analysis of ACTN4 expression in MCF-7.

ACTN4 monoclonal antibody (M01A), clone 4D10 Western Blot analysis of ACTN4 expression in Hela S3 NE.

ACTN4 monoclonal antibody (M01A), clone 4D10. Western Blot analysis of ACTN4 expression in Raw 264.7.

ACTN4 monoclonal antibody (M01A), clone 4D10. Western Blot analysis of ACTN4 expression in NIH/3T3.

Western Blot analysis of ACTN4 expression in transfected 293T cell line by ACTN4 monoclonal antibody (M01A), clone 4D10. Lane 1: ACTN4 transfected lysate(104.9 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (37.84 KDa).
Documents Download
Request a Document
Protocol Information
ACTN4 monoclonal antibody (M01A), clone 4D10 (orb2296436)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review