Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

ACVR1C/ALK7 Antibody

SKU: orb1535738

Description

ACVR1C/ALK7 Antibody

Research Area

Product Categories/Products/Antibodies

Images & Validation

Tested ApplicationsIHC, IHC-P, WB
Dilution RangeIHC (1:100 - 1:200), IHC-P (1:67), WB (1:500 - 1:2000)
ReactivityHuman, Mouse, Rat
Application Notes
Further information: The predicted MW is 37kDa/46kDa/49kDa/54kDa, while the observed MW by Western blot was 60kDa.

Key Properties

HostRabbit
ClonalityPolyclonal
IsotypeIgG
ImmunogenRecombinant fusion protein containing a sequence corresponding to amino acids 22-113 of human ACVR1C (NP_660302.2). LSPGLKCVCLLCDSSNFTCQTEGACWASVMLTNGKEQVIKSCVSLPELNAQVFCHSSNNVTKTECCFTDFCNNITLHLPTASPNAPKLGPME
TargetACVR1C / ALK7
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesPBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol. PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Concentration0.67 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

ACVR1C, Activin receptor-like kinase 7, ACTR-IC, Activin receptor type IC, ACVRLK7, Activin receptor type-1C, ALK7, Activin A receptor, type IC, ALK-7

Similar Products

  • ACVR1C/ALK7 Antibody [orb1537986]

    ELISA,  IHC,  IHC-P,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    0.05 mg
  • ACVR1C/ALK7 Antibody [orb1534414]

    IHC,  IHC-P

    Bovine, Human, Mammal, Porcine

    Rabbit

    Polyclonal

    Unconjugated

    50 μg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol
IHC-P
Immunohistochemistry Paraffin
View Protocol

Available Sizes

Select a size below

50 μl
$ 640.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 2-3 weeks
Bulk Enquiry