You have no items in your shopping cart.
Description
Images & Validation
−| Tested Applications | ELISA, WB |
|---|---|
| Reactivity | Human, Mouse, Rat |
Key Properties
−| Host | Mouse |
|---|---|
| Clonality | Polyclonal |
| Immunogen | ADD3 (NP_058432, 462 a.a. ~ 560 a.a) partial recombinant protein with GST tag. |
| Protein Sequence | PRTKITWMKAEDSSKVSGGTPIKIEDPNQFVPLNTNPNEVLEKRNKIREQNRYDLKTAGPQSQLLAGIVVDKPPSTMQFEDDDHGPPAPPNPFSHLTEG |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | 50 % glycerol |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

ADD3 polyclonal antibody (A01), Western Blot analysis of ADD3 expression in K-562.

ADD3 polyclonal antibody (A01), Western Blot analysis of ADD3 expression in Raw 264.7.

ADD3 polyclonal antibody (A01), Western Blot analysis of ADD3 expression in NIH/3T3.

ADD3 polyclonal antibody (A01), Western Blot analysis of ADD3 expression in PC-12.

Western Blot detection against Immunogen (37 KDa).
Documents Download
Request a Document
Protocol Information
ADD3 polyclonal antibody (A01) (orb2296368)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review