Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

AHR Rabbit Polyclonal Antibody

SKU: orb573872

Description

Rabbit polyclonal antibody to AHR

Research Area

Product Categories/Antibodies/Primary Antibodies,Epigenetics,Product Categories/Antibodies,Root Catalog/Products/Polyclonal Antibodies,Root Catalog/Products/Polyclonal Antibodies/Transcription Factor,Root Catalog/Products/Polyclonal Antibodies/Transcription Regulation,Root Catalog/Products/Polyclonal Antibodies/Cell Cycle Proteins,Root Catalog/Research Areas/Receptors,Root Catalog/Research Areas/Transcription Factors,Root Catalog/Research Areas/Cell Morphogenesis,Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies,Root Catalog/Products/Primary Antibodies,Root Catalog/Products/Aviva Rabbit Polyclonal

Images & Validation

Tested ApplicationsWB
ReactivityHuman
Predicted ReactivityBovine, Canine, Guinea pig, Mouse, Rabbit, Rat

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human AHR
TargetAHR
Protein SequenceSynthetic peptide located within the following region: MNSSSANITYASRKRRKPVQKTVKPIPAEGIKSNPSKRHRDRLNTELDRL
Molecular Weight96kDa
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration1.0 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

RP85, bHLHe76

Similar Products

  • AHR Rabbit Polyclonal Antibody [orb4234]

    FC,  ICC,  IF,  IHC-Fr,  IHC-P

    Mouse

    Human, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μl, 50 μl, 200 μl
  • Ah Receptor rabbit pAb [orb764486]

    ELISA,  IF,  IHC-P,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    100 μl, 50 μl
  • Ah Receptor (phospho Ser36) rabbit pAb [orb767943]

    ELISA,  IHC-P,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    100 μl, 50 μl
  • AhR (Phospho-Ser36) Antibody [orb127659]

    IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg, 200 μg, 50 μg, 25 μg
  • Anti-Ah Receptor Antibody [orb412003]

    IH,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 200 μl, 100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

AHR Rabbit Polyclonal Antibody

AHR antibody - N-terminal region (orb573872) validated by WB using Human HepG2 Lysate at 2.5 ug/ml, 5 ug/ml.

AHR Rabbit Polyclonal Antibody

Sample Tissue: Human U937 Whole Cell, Antibody dilution: 1 ug/ml.

AHR Rabbit Polyclonal Antibody

Positive control (+): A549 (N03), Negative control (-): THP-1 (N30), Antibody concentration: 5 ug/ml.

AHR Rabbit Polyclonal Antibody

Lanes: Lane 1: 50 ug HepG2 nuclei extract + benzo[a]pyrene, Lane 2: 50 ug HepG2 cytoplasm extract + benzo[a]pyrene, Primary Antibody dilution: 1:1000, Secondary Antibody: Anti-rabbit HRP, Secondary Antibody dilution: 1:1000, Gene Name: AHR (Arylhydrocarbon receptor).

AHR Rabbit Polyclonal Antibody

Rabbit Anti-AHR Antibody, Catalog Number: orb573872, Formalin Fixed Paraffin Embedded Tissue: Human Urinary Bladder Tissue, Observed Staining: Cytoplasm, Primary Antibody Concentration: 1:100, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

AHR Rabbit Polyclonal Antibody

WB Suggested Anti-AHR Antibody Titration: 2.5 ug/ml, ELISA Titer: 1:12500, Positive Control: Human Placenta.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_001612

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

AHR Rabbit Polyclonal Antibody (orb573872)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 540.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry