AHR monoclonal antibody (M02), clone 3B12

SKU: orb2296269

Description

Mouse monoclonal antibody raised against a partial recombinant AHR.

Images & Validation

• Tested Applications: ELISA, IF, IP, WB
• Reactivity: Human

Key Properties

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG1 Kappa
• Clone No.: 3B12
• Immunogen: AHR (NP_001612, 721 a.a. ~ 820 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: MGSFEPSPYPTTSSLEDFVTCLQLPENQKHGLNPQSAIITPQTCYAGAVSMYQCQPEPQHTHVGQMQYNPVLPGQQAFLNKFQNGVLNETYPAELNNINN
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Western Blot analysis of AHR expression in transfected 293T cell line by AHR monoclonal antibody (M02), clone 3B12. Lane 1: AHR transfected lysate(96.147 KDa). Lane 2: Non-transfected lysate.

Immunoprecipitation of AHR transfected lysate using anti-AHR monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with AHR MaxPab rabbit polyclonal antibody.

Detection limit for recombinant GST tagged AHR is approximately 0.03 ng/ml as a capture antibody.

Western blot analysis of AHR over-expressed 293 cell line, cotransfected with AHR Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with AHR monoclonal antibody (M02), clone 3B12. GAPDH (36.1 kDa) used as specificity and loading control.

Immunofluorescence of monoclonal antibody to AHR on HeLa cell. [antibody concentration 10 ug/ml]

Western Blot detection against Immunogen (36.74 KDa).

Quick Database Links

RefSeq (Protein):NP_001612