You have no items in your shopping cart.
Description
Research Area
Images & Validation
−| Tested Applications | WB |
|---|---|
| Reactivity | Human, Mouse |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Porcine, Rabbit, Rat, Sheep, Zebrafish |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human PDCD8 |
| Target | AIFM1 |
| Protein Sequence | Synthetic peptide located within the following region: VDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEASEITIPPST |
| Molecular Weight | 36kDa |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−AIF-M1 rabbit pAb [orb764490]
ELISA, IF, IHC-P, WB
Human, Mouse, Rat
Polyclonal
Unconjugated
100 μl, 50 μlAIF Rabbit Polyclonal Antibody [orb10071]
WB
Bovine, Canine, Gallus, Rabbit, Sheep
Human, Mouse, Porcine, Rat
Rabbit
Polyclonal
Unconjugated
50 μl, 100 μl, 200 μlAIFM1 Rabbit Polyclonal Antibody [orb592665]
WB
Bovine, Canine, Equine, Porcine, Rabbit
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
100 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

AIFM1 was immunoprecipitated from 2 mg HEK293 Whole Cell Lysate with orb324833 with 1:200 dilution. Western blot was performed using orb324833 at 1/1000 dilution, Lane 1: Control IP in HEK293 Whole Cell Lysate, Lane 2: AIFM1 IP with orb324833 in HEK293 Whole Cell Lysate, Lane 3: Input of HEK293 Whole Cell Lysate.

Sample Tissue: Mouse Liver, Antibody Dilution: 1 ug/mL.

Sample Tissue: Mouse Liver, Antibody Dilution: 1 ug/mL.

Rabbit Anti-AIFM1 Antibody, Catalog Number: orb324833, Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue, Observed Staining: Cytoplasmic, nucleus, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5 - 2.0 sec.

Rabbit Anti-AIFM1 Antibody, Catalog Number: orb324833, Formalin Fixed Paraffin Embedded Tissue: Human Kidney Tissue, Observed Staining: Cytoplasm, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5 - 2.0 sec.

WB Suggested Anti-PDCD8 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: Jurkat cell lysate, AIFM1 is supported by BioGPS gene expression data to be expressed in Jurkat.
Documents Download
Request a Document
PDCD8 Rabbit Polyclonal Antibody (orb324833)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review


















