AK1 monoclonal antibody (M06), clone 3A6-1F5

SKU: orb2296251

Description

Mouse monoclonal antibody raised against a full length recombinant AK1.

Images & Validation

• Tested Applications: ELISA, IF, IP, WB
• Reactivity: Human

Key Properties

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG1 Kappa
• Clone No.: 3A6-1F5
• Immunogen: AK1 (AAH01116, 1 a.a. ~ 194 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: MEEKLKKTNIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRSEVSSGSARGKKLSEIMEKGQLVPLETVLDMLRDAMVAKVNTSKGFLIDGYPREVQQGEEFERRIGQPTLLLYVDAGPETMTQRLLKRGETSGRVDDNEETIKKRLETYYKATEPVIAFYEKRGIVRKVNAEGSVDSVFSQVCTHLDALK
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Immunofluorescence of monoclonal antibody to AK1 on HeLa cell. [antibody concentration 10 ug/ml]

Western Blot detection against Immunogen (47.08 KDa).

AK1 monoclonal antibody (M06), clone 3A6-1F5 Western Blot analysis of AK1 expression in HeLa.

Western Blot analysis of AK1 expression in transfected 293T cell line by AK1 monoclonal antibody (M06), clone 3A6-1F5. Lane 1: AK1 transfected lysate(21.6 KDa). Lane 2: Non-transfected lysate.

Immunoprecipitation of AK1 transfected lysate using anti-AK1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with AK1 MaxPab rabbit polyclonal antibody.

Western blot analysis of AK1 over-expressed 293 cell line, cotransfected with AK1 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with AK1 monoclonal antibody (M06), clone 3A6-1F5. GAPDH (36.1 kDa) used as specificity and loading control.

Quick Database Links

RefSeq:AAH01116