ALDH1A1 purified MaxPab rabbit polyclonal antibody (D01P)

SKU: orb2296205

This product can be custom made

Description

Rabbit polyclonal antibody raised against a full-length human ALDH1A1 protein.

Images & Validation

−

Item 1 of 6

Tested Applications	WB
Reactivity	Human, Mouse

Key Properties

−

Host	Rabbit
Clonality	Polyclonal
Immunogen	ALDH1A1 (NP_000680.2, 1 a.a. ~ 501 a.a) full-length human protein.
Protein Sequence	MSSSGTPDLPVLLTDLKIQYTKIFINNEWHDSVSGKKFPVFNPATEEELCQVEEGDKEDVDKAVKAARQAFQIGSPWRTMDASERGRLLYKLADLIERDRLLLATMESMNGGKLYSNAYLNDLAGCIKTLRYCAGWADKIQGRTIPIDGNFFTYTRHEPIGVCGQIIPWNFPLVMLIWKIGPALSCGNTVVVKPAEQTPLTALHVASLIKEAGFPPGVVNIVPGYGPTAGAAISSHMDIDKVAFTGSTEVGKLIKEAAGKSNLKRVTLELGGKSPCIVLADADLDNAVEFAHHGVFYHQGQCCIAASRIFVEESIYDEFVRRSVERAKKYILGNPLTPGVTQGPQIDKEQYDKILDLIESGKKEGAKLECGGGPWGNKGYFVQPTVFSNVTDEMRIAKEEIFGPVQQIMKFKSLDDVIKRANNTFYGLSAGVFTKDIDKAITISSALQAGTVWVNCYGVVSAQCPFGGFKMSGNGRELGEYGFHEYTEVKTVTVKISQKNS
Conjugation	Unconjugated

Storage & Handling

−

Storage	Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/Preservatives	In 1x PBS, pH 7.4
Expiration Date	12 months from date of receipt.
Disclaimer	For research use only

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

ALDH1A1 purified MaxPab rabbit polyclonal antibody (D01P)

ALDH1A1 MaxPab rabbit polyclonal antibody. Western Blot analysis of ALDH1A1 expression in HepG2.

ALDH1A1 MaxPab rabbit polyclonal antibody. Western Blot analysis of ALDH1A1 expression in human liver.

ALDH1A1 MaxPab rabbit polyclonal antibody. Western Blot analysis of ALDH1A1 expression in K-562.

ALDH1A1 MaxPab rabbit polyclonal antibody. Western Blot analysis of ALDH1A1 expression in mouse liver.

ALDH1A1 MaxPab rabbit polyclonal antibody. Western Blot analysis of ALDH1A1 expression in mouse lung.

Western Blot analysis of ALDH1A1 expression in transfected 293T cell line by ALDH1A1 MaxPab polyclonal antibody. Lane 1: ALDH1A1 transfected lysate(54.90 KDa). Lane 2: Non-transfected lysate.

Quick Database Links

RefSeq (Protein):NP_000680.2

NCBI Reference Sequences

−

Associated Accession Numbers

Curated reference sequences for the gene transcript and protein product

Protein	NP_000680.2

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Western Blot (IB, immunoblot)

View Protocol

Find More Protocols