Anti-Cathepsin D

SKU: orb180468

Featured

Description

Goat polyclonal antibody to Cathepsin D. Cathepsin D is a lysosomal aspartic protease of the pepsin family. Acid protease active in intracellular protein breakdown. It is composed of a dimer of disulphide-linked heavy and light chains, both produced from a single protein precursor. It is involved in the pathogenesis of several diseases such as breast cancer and possibly Alzheimer disease.

Images & Validation

−

Item 1 of 3

Tested Applications	IEM, IF, IHC-Fr, IHC-P, WB
Dilution Range	WB:1:250-1:1,000, IF:1:50-1:200, IHC-P:1:200-1:1,000, IHC-F:1:200-1:1,000, IEM:1:50-1:200
Reactivity	Bovine, Canine, Donkey, Equine, Feline, Gallus, Goat, Guinea pig, Hamster, Human, Mouse, Other, Porcine, Primate, Rabbit, Rat, Sheep
Application Notes	The antibody solution should be gently mixed before use.

Key Properties

−

Antibody Type	Primary Antibody
Host	Goat
Clonality	Polyclonal
Isotype	IgG
Immunogen	Antigen: Purified recombinant peptide derived from within residues 275 aa to the C-terminus of human Cathepsin D produced in E. coli.. Antigen Sequence: DQVEVASGLTLCKEGCEAIVDTGTSLMVGPVDEVRELQKAIGAVPLIQGEYMIPCEKVSTLPAITLKLGGKGYKLSPEDYTLKVSQAGKTLCLSGFMGMDIPPPSGPLWILGDVFIGRYYTVFDRDNNRVGFAEAARL
Target	Cathepsin D
Conjugation	Unconjugated

Customer Validated Data

−

The data below is submitted by researchers worldwide. We provide this transparency to help you decide if this product works for your specific application or species, even if we haven't tested it ourselves.

Success by Application

Reactivity Distribution

Latest Experiments

3 Results

Dilution

Sample

Summary

Murine

1:100

MOVAS cell line

This antibody was applied in immunofluorescence...

Mouse

1:100

Paraffin-embedded tissue sections

This was applied in immunofluorescence labeling...

Human

1:500

ARPE19 cell fractions

This was applied in immunoblotting to...

Storage & Handling

−

Storage	Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/Preservatives	PBS, 20% glycerol and 0.05% sodium azide
Concentration	1 mg/ml
Expiration Date	12 months from date of receipt.
Disclaimer	For research use only

Alternative Names

−

ceroid-lipofuscinosis, CLN10; CPSD, CTSD, lysosomal aspartyl protease, lysosomal aspartyl peptidase, neuronal 10 antibody.

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].