Anti-CAV2

SKU: orb182399

Description

Goat polyclonal to Caveolin-2 – caveolae marker. This scaffolding protein acts as an accessory protein in conjunction with CAV1 in targeting to lipid rafts and driving caveolae formation. It is involved in essential cellular functions, including cellular growth control, apoptosis, lipid metabolism and signal transduction. CAV2 might function as a tumor suppressor as well.

Images & Validation

• Tested Applications: IF, IHC-Fr, IHC-P, WB
• Dilution Range: WB:1:500-1:2,000, IF:1:50-1:200, IHC-P:1:200-1:1,000, IHC-F:1:200-1:1,000
• Reactivity: Bovine, Canine, Donkey, Equine, Feline, Gallus, Goat, Guinea pig, Hamster, Human, Mouse, Other, Porcine, Primate, Rabbit, Rat, Sheep
• Application Notes:
  The antibody solution should be gently mixed before use.

Key Properties

• Antibody Type: Primary Antibody
• Host: Goat
• Clonality: Polyclonal
• Isotype: IgG
• Immunogen: Antigen: Recombinant peptide derived from within residues 50 aa to the N-terminus of human CAV2 produced in E. coli.. Antigen Sequence: MDDDSYSHHSGLEYADPEKFADSDQDRDPHRLNSHLKLGFEDVIAEPVTTH
• Target: Caveolin-2
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: PBS, 20% glycerol and 0.05% sodium azide
• Concentration: 1 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

CAV2, caveolin, caveolae protein 2 antibody.

Quick Database Links

Gene Symbol

Caveolin-2