You have no items in your shopping cart.
Description
Images & Validation
−| Tested Applications | IF, IHC-Fr, IHC-P, WB |
|---|---|
| Dilution Range | WB:1:500-1:2,000, IF:1:50-1:200, IHC-P:1:200-1:1,000, IHC-F:1:200-1:1,000 |
| Reactivity | Bovine, Canine, Donkey, Equine, Feline, Gallus, Goat, Guinea pig, Hamster, Human, Mouse, Other, Porcine, Primate, Rabbit, Rat, Sheep |
| Application Notes |
Key Properties
−| Antibody Type | Primary Antibody |
|---|---|
| Host | Goat |
| Clonality | Polyclonal |
| Isotype | IgG |
| Immunogen | Antigen: Recombinant peptide derived from within residues 50 aa to the N-terminus of human CAV2 produced in E. coli.. Antigen Sequence: MDDDSYSHHSGLEYADPEKFADSDQDRDPHRLNSHLKLGFEDVIAEPVTTH |
| Target | Caveolin-2 |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | PBS, 20% glycerol and 0.05% sodium azide |
| Concentration | 1 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−CAV2, caveolin, caveolae protein 2 antibody.
Similar Products
−Caveolin-2 (phospho Tyr27) rabbit pAb [orb770703]
ELISA, WB
Human, Mouse, Rat
Polyclonal
Unconjugated
100 μl, 50 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
Gene Symbol
Caveolin-2
Protocol Information
WB
Western Blot (IB, immunoblot)
IHC-P
Immunohistochemistry Paraffin
IHC-Fr
Immunohistochemistry Frozen
IF
Immunofluorescence





