You have no items in your shopping cart.
Description
Images & Validation
−
| Tested Applications | WB |
|---|---|
| Dilution Range | WB:1:1,000-1:5,000 |
| Reactivity | Human |
| Application Notes |
Key Properties
−| Antibody Type | Primary Antibody |
|---|---|
| Host | Goat |
| Clonality | Polyclonal |
| Isotype | IgG |
| Immunogen | Antigen: Purified recombinant peptide derived from within residues 389 aa to the C-terminus of human CCBE1 produced in E. coli.. Antigen Sequence: SCRKRCSGTGLTLQQRSSLYLRNFPATQKPWTWALEMTIQEELRQET |
| Target | collagen and calcium binding EGF domains 1 antibody |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | For continuous use, store at 2-8°C for one-two days. For extended storage, store in -20°C freezer. Working dilution samples should be discarded if not used within 12 hours. |
|---|---|
| Form/Appearance | Polyclonal antibody supplied as a 100 µl (3 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. |
| Buffer/Preservatives | PBS, 20% glycerol and 0.05% sodium azide |
| Concentration | 3 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−collagen and calcium binding EGF domains 1 antibody
Similar Products
−Anti-CCBE1 Antibody [orb215381]
WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
30 μl, 100 μl, 200 μlRabbit anti-CCBE1 Antibody [orb1194054]
WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
50 μl, 100 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
Gene Symbol
collagen and calcium binding EGF domains 1 antibody

