Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

anti-Envelope Protein (SARS-CoV-2)

SKU: orb1463314

Description

Envelope (E) is one of the structural proteins of the virus. This protein is a small polypeptide that contains at least one α-helical transmembrane domain and it involved in life cycle of SARS-CoV-2, such as assembly, budding, envelope formation.

Images & Validation

Tested ApplicationsWB
Dilution RangeWB:1:500-1:2,000
ReactivityVirus
Application Notes
The antibody solution should be gently mixed before use.

Key Properties

Antibody TypePrimary Antibody
HostGoat
ClonalityPolyclonal
IsotypeIgG
ImmunogenAntigen: Affinity purified recombinant fusion protein using the C-terminal of Envelope protein (residues 45 to stop) and produced in E. coli.. Antigen Sequence: MNIVNVSLVKPSFYVYSRVKNLNSSRVPDLLV
TargetEnvelope Protein (SARS-CoV-2)
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesPBS, 20% glycerol and 0.05% sodium azide
Concentration1 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

ORF4, E SARS Coronavirus-2 antibody.
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

Available Sizes

Select a size below

100 μg
$ 280.00
Choose Conjugation or Carrier Free Version
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 2-3 weeks
Bulk Enquiry