Anti-HIF1a

SKU: orb153330

Description

Goat polyclonal to alpha subunit of transcription factor hypoxia-inducible factor-1 (HIF-1), which is a heterodimer composed of an alpha and a beta subunit. HIF-1 functions as a master regulator of cellular and systemic homeostatic response to hypoxia by activating transcription of many genes, including those involved in apoptosis, angiogenesis, energy metabolism, and other genes whose protein products increase oxygen delivery or facilitate metabolic adaptation to hypoxia. HIF-1 thus plays an essential role in tumour angiogenesis, embryonic vascularization, and pathophysiology of ischemic disease.

Images & Validation

• Tested Applications: WB
• Dilution Range: WB:1:500-1:2,000
• Reactivity: Bovine, Canine, Donkey, Equine, Feline, Gallus, Goat, Guinea pig, Hamster, Human, Mouse, Other, Porcine, Primate, Rabbit, Rat, Sheep
• Application Notes:
  The antibody solution should be gently mixed before use.

Key Properties

• Antibody Type: Primary Antibody
• Host: Goat
• Clonality: Polyclonal
• Isotype: IgG
• Immunogen: Antigen: Purified recombinant peptide derived from within residues 780 aa to the C-terminus of human HIF1a produced in E. coli.. Antigen Sequence: LLGQSMDESGLPQLTSYDCEVNAPIQGSRNLLQGEELLRALDQVN
• Target: Hypoxia inducible factor 1, alpha subunit (basic helix-loop-helix transcription factor)
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: PBS, 20% glycerol and 0.05% sodium azide
• Concentration: 1 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

alpha subunit (basic helix-loop-helix transcription factor), ARNT interacting protein, basic-helix-loop-helix-PAS protein MOP1, bHLHe78, class E basic helix-loop-helix protein 78, HIF-1alpha, HIF1, HIF1-ALPHA, HIF1a, hypoxia inducible factor 1, hypoxia-inducible factor 1 alpha isoform I.3, hypoxia-inducible factor 1, hypoxia-inducible factor 1-alpha, member of PAS protein 1, member of PAS superfamily 1, MOP1, PASD8, PAS domain-containing protein 8 antibody.

Quick Database Links

Gene Symbol

Hypoxia inducible factor 1, alpha subunit (basic helix-loop-helix transcription factor)