Anti-P53

SKU: orb153342

Description

Goat polyclonal antibody to P53. This protein reacts to diverse cellular stresses to regulate target genes that induce apoptosis, senescence, cell cycle arrest, DNA repair, or changes in metabolism. p53 is a DNA-binding protein containing transcription activation, DNA-binding, and oligomerization domains. It is assumed to bind to a p53-binding site and activate expression of downstream genes that inhibit growth and/or invasion, and thus function as a tumour suppressor.

Images & Validation

• Tested Applications: IF, WB
• Dilution Range: WB:1:500-1:2,000, IF:1:50-1:250
• Reactivity: Bovine, Canine, Donkey, Equine, Feline, Gallus, Goat, Guinea pig, Hamster, Human, Mouse, Other, Porcine, Primate, Rabbit, Rat, Sheep
• Application Notes:
  The antibody solution should be gently mixed before use.

Key Properties

• Antibody Type: Primary Antibody
• Host: Goat
• Clonality: Polyclonal
• Isotype: IgG
• Immunogen: Antigen: Purified recombinant peptide derived from within residues 280 aa to the C-terminus of human P53 produced in E. coli.. Antigen Sequence: DRRTEEENLRKKGEPHHELPPGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPGGSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD
• Target: Tumor protein p53
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: PBS, 20% glycerol and 0.05% sodium azide
• Concentration: 1 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

BCC7, LFS1 and TRP53 antibody.

Quick Database Links

Gene Symbol

Tumor protein p53