Anti-Rab27a

SKU: orb11622

Description

Goat polyclonal antibody to mouse Rab27a. Rab27a belongs to the small GTPase superfamily, Rab family. The protein is membrane-bound and involved in lysosome-related vesicle transport and small GTPase mediated signal transduction.

Images & Validation

• Tested Applications: IF, IHC-Fr, IHC-P, WB
• Dilution Range: WB:1:250-1:2,000, IF:1:50-1:200, IHC-P:1:50-1:400, IHC-F:1:50-1:400
• Reactivity: Bovine, Canine, Donkey, Equine, Feline, Gallus, Goat, Guinea pig, Hamster, Human, Mouse, Other, Porcine, Primate, Rabbit, Rat, Sheep
• Application Notes:
  The antibody solution should be gently mixed before use.

Key Properties

• Antibody Type: Primary Antibody
• Host: Goat
• Clonality: Polyclonal
• Isotype: IgG
• Immunogen: Antigen: Purified recombinant peptide derived from within residues 120 aa to the C-terminus of mouse Rab27a produced in E. coli.. Antigen Sequence: MHAYCENPDIVLCGNKSDLEDQRAVKEEEARELAEKYGIPYFETSAANGTNISQAIEMLLDLIMKRMERCVDKSWIPEGVVRSNGHTSTDQLSEEKEKGLCGC
• Target: RAB27A, member RAS oncogene family
• Conjugation: Unconjugated

Storage & Handling

• Storage: For continuous use, store at 2-8 deg;C for one-two days. For extended storage, store in -20 deg;C freezer. Working dilution samples should be discarded if not used within 12 hours.
• Form/Appearance: Polyclonal antibody supplied as a 200 or 500 µl (1 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.
• Buffer/Preservatives: PBS, 20% glycerol and 0.05% sodium azide
• Concentration: 1 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

GS2, GTP-binding protein Ram, rab-27, ras-related protein Rab-27A, RAB27, RAM antibody.

Quick Database Links

Gene Symbol

RAB27A, member RAS oncogene family