Anti-Rab28

SKU: orb11632

Description

RAB28 belongs to the large RAB family of low molecular weight GTPases that are involved in intracellular membrane trafficking.

Images & Validation

• Tested Applications: IF, WB
• Dilution Range: WB:1:250-1:2,000, IF:1:25-1:250
• Reactivity: Bovine, Canine, Donkey, Equine, Feline, Gallus, Goat, Guinea pig, Hamster, Human, Mouse, Other, Porcine, Primate, Rabbit, Rat, Sheep
• Application Notes:
  The antibody solution should be gently mixed before use.

Key Properties

• Antibody Type: Primary Antibody
• Host: Goat
• Clonality: Polyclonal
• Isotype: IgG
• Immunogen: Antigen: Purified recombinant peptide derived from within residues 120 aa to the C-terminus of mouse Rab28 produced in E. coli.. Antigen Sequence: MSETQPLVALVGNKIDLEHMRTVKADKHLRFCQENGFSSHFVSAKTGDSVFLCFQKVAAEILGIKLNKAEIEQSQRVVKADIVNYNQEPLSRTVNPPRSSMCAVQ
• Target: RAB28, member RAS oncogene family
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: PBS, 20% glycerol and 0.05% sodium azide
• Concentration: 1 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

RAB1C, GTP-binding protein RAY, H-ray, ras-related protein Rab-35; ras-related protein rab-1C and RAY antibody.

Quick Database Links

Gene Symbol

RAB28, member RAS oncogene family