You have no items in your shopping cart.
Description
Images & Validation
−| Tested Applications | IHC-Fr, IHC-P, WB |
|---|---|
| Dilution Range | WB:1:250-1:2,000, IHC-P:1:200-1:750, IHC-F:1:200-1:750 |
| Reactivity | Bovine, Canine, Donkey, Equine, Feline, Gallus, Goat, Guinea pig, Hamster, Human, Mouse, Other, Porcine, Primate, Rabbit, Rat, Sheep |
| Application Notes |
Key Properties
−| Antibody Type | Primary Antibody |
|---|---|
| Host | Goat |
| Clonality | Polyclonal |
| Isotype | IgG |
| Immunogen | Antigen: Purified recombinant peptide derived from within residues 118 aa to the C-terminus of mouse Rab5c produced in E. coli.. Antigen Sequence: ELQRQASPNIVIALAGNKADLASKRAVEFQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAKKLPKNEPQNAAGAPGRTRGVDLQESNPASRSQCCSN |
| Target | RAB5C, member RAS oncogene family |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | PBS, 20% glycerol and 0.05% sodium azide |
| Concentration | 1 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−L1880, RAB5C, RAS-associated protein RAB5C, ras-related protein Rab-5C, Rab5L antibody.
Similar Products
−Anti-RAB5C Antibody [orb315812]
IH, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
200 μl, 100 μl, 30 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
Gene Symbol
RAB5C, member RAS oncogene family
Protocol Information
WB
Western Blot (IB, immunoblot)
IHC-P
Immunohistochemistry Paraffin
IHC-Fr
Immunohistochemistry Frozen










