You have no items in your shopping cart.
Description
Images & Validation
−
Item 1 of 1
| Tested Applications | WB |
|---|---|
| Dilution Range | WB:1:500-1:2,000 |
| Reactivity | Virus |
| Application Notes |
Key Properties
−| Antibody Type | Primary Antibody |
|---|---|
| Host | Goat |
| Clonality | Polyclonal |
| Isotype | IgG |
| Immunogen | Antigen: Purified recombinant peptide derived from within residues 55 aa to N-terminal of RYMV P1 produced in E. coli.. Antigen Sequence: MTRLEVLIRPTEQTVAKAIAVGYTHTLTWVWYPQTWDVDSVNDPVLRADFDPDRAG |
| Target | RYMV P1 |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | PBS, 20% glycerol and 0.05% sodium azide |
| Concentration | 1 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−P1 (ORF1), RYMV, Rice Yellow Mottle Virus antibody.
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
Gene Symbol
RYMV P1
Available Sizes
Select a size below
Choose Conjugation or Carrier Free Version
Free Secondary Antibody (20 ul)0/0
Please add an antibody product to your cart first.
Usually dispatched within 2-3 weeks