SARS-CoV-2 NSP3 Antibody

SKU: orb738429

Description

Anti-SARS-CoV-2 NSP3 Antibody. Tested in ELISA applications. This antibody reacts with Human.

Images & Validation

• Tested Applications: ELISA
• Reactivity: Human
• Application Notes:
  ELISA, 0.001-0.1μg/ml, Human. Add 0.2ml of distilled water will yield a concentration of 500ug/ml

Key Properties

• Antibody Type: Primary Antibody
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: Rabbit IgG
• Immunogen: HSLSHFVNLDNLRANNTKGSLPINVIVFDGKSKCEESSAKSASVYYSQLMCQPILLLDQALVSDVGDSAEVAVKMFDAYVNTFSSTFNVPMEKLKTLVATAEAELAKNVSLDNVLSTFISAARQGFVDSDVETKDVVECLKLSHQSDIEVTGDSCNNYMLTYNKVENMTPRDLGACIDCSARHINAQVAKSHNIALIWNVKDFMSLSEQLRKQIRSAAKKNNLPFKLTCATTRQVVNVVTTKIALK
• Molecular Weight: 140 kDa, 130 kDa, 110 kDa
• Purification: Immunogen affinity purified.
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Form/Appearance: Lyophilized
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

Replicase polyprotein 1ab; pp1ab; ORF1ab polyprotein; nsp3; Non-structural protein 3; PL2-PRO; Papain-like proteinase; PL-PRO

Quick Database Links

UniProt

P0DTD1, P0DTC1

Peter E Cockram 1 2, Benjamin T Walters 3, Aaron Lictao 3, Frances Shanahan 2, Ingrid E Wertz 2, Scott A Foster 2, Joachim Rudolph Allosteric Inhibitors of the SARS-COV-2 Papain-like Protease Domain Induce Proteasomal Degradation of Its Parent Protein NSP3 ACS Chem Biol, (2024)

PubMed: 38150587

Applications

WB