ANXA4 MaxPab rabbit polyclonal antibody (D01)

SKU: orb2296050

This product can be custom made

Description

Rabbit polyclonal antibody raised against a full-length human ANXA4 protein.

Images & Validation

−

Item 1 of 10

Tested Applications	IP, WB
Reactivity	Human, Mouse, Rat

Key Properties

−

Host	Rabbit
Clonality	Polyclonal
Immunogen	ANXA4 (NP_001144.1, 1 a.a. ~ 321 a.a) full-length human protein.
Protein Sequence	MAMATKGGTVKAASGFNAMEDAQTLRKAMKGLGTDEDAIISVLAYRNTAQRQEIRTAYKSTIGRDLIDDLKSELSGNFEQVIVGMMTPTVLYDVQELRRAMKGAGTDEGCLIEILASRTPEEIRRISQTYQQQYGRSLEDDIRSDTSFMFQRVLVSLSAGGRDEGNYLDDALVRQDAQDLYEAGEKKWGTDEVKFLTVLCSRNRNHLLHVFDEYKRISQKDIEQSIKSETSGSFEDALLAIVKCMRNKSAYFAEKLYKSMKGLGTDDNTLIRVMVSRAEIDMLDIRAHFKRLYGKSLYSFIKGDTSGDYRKVLLVLCGGDD
Conjugation	Unconjugated

Storage & Handling

−

Storage	Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/Preservatives	No additive
Expiration Date	12 months from date of receipt.
Disclaimer	For research use only

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

ANXA4 MaxPab rabbit polyclonal antibody (D01)

ANXA4 MaxPab rabbit polyclonal antibody. Western Blot analysis of ANXA4 expression in A-431.

ANXA4 MaxPab rabbit polyclonal antibody. Western Blot analysis of ANXA4 expression in human stomach.

ANXA4 MaxPab rabbit polyclonal antibody. Western Blot analysis of ANXA4 expression in K-562.

ANXA4 MaxPab rabbit polyclonal antibody. Western Blot analysis of ANXA4 expression in mouse brain.

ANXA4 MaxPab rabbit polyclonal antibody. Western Blot analysis of ANXA4 expression in mouse intestine.

ANXA4 MaxPab rabbit polyclonal antibody. Western Blot analysis of ANXA4 expression in PC-12.

ANXA4 MaxPab rabbit polyclonal antibody. Western Blot analysis of ANXA4 expression in rat brain.

ANXA4 MaxPab rabbit polyclonal antibody. Western Blot analysis of ANXA4 expression in Raw 264.7.

Immunoprecipitation of ANXA4 transfected lysate using anti-ANXA4 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with ANXA4 purified MaxPab mouse polyclonal antibody (B01P) (orb2296051).

Western Blot analysis of ANXA4 expression in transfected 293T cell line by ANXA4 MaxPab polyclonal antibody. Lane 1: ANXA4 transfected lysate(36.10 KDa). Lane 2: Non-transfected lysate.

Quick Database Links

RefSeq (Protein):NP_001144.1

NCBI Reference Sequences

−

Associated Accession Numbers

Curated reference sequences for the gene transcript and protein product

Protein	NP_001144.1

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Western Blot (IB, immunoblot)

View Protocol

Immunoprecipitation

View Protocol

Find More Protocols