APOA1 purified MaxPab rabbit polyclonal antibody (D01P)

SKU: orb2295987

Description

Rabbit polyclonal antibody raised against a full-length human APOA1 protein.

Images & Validation

• Tested Applications: PLA, WB
• Reactivity: Human, Mouse

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: APOA1 (NP_000030.1, 1 a.a. ~ 267 a.a) full-length human protein.
• Protein Sequence: MKAAVLTLAVLFLTGSQARHFWQQDEPPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGSALGKQLNLKLLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQ
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

APOA1 MaxPab rabbit polyclonal antibody. Western Blot analysis of APOA1 expression in HeLa.

APOA1 MaxPab rabbit polyclonal antibody. Western Blot analysis of APOA1 expression in human kidney.

APOA1 MaxPab rabbit polyclonal antibody. Western Blot analysis of APOA1 expression in mouse brain.

Proximity Ligation Analysis of protein-protein interactions between APOA1 and FGA. HeLa cells were stained with anti-APOA1 rabbit purified polyclonal 1:1200 and anti-FGA mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).

Western Blot analysis of APOA1 expression in transfected 293T cell line by APOA1 MaxPab polyclonal antibody. Lane 1: APOA1 transfected lysate(30.80 KDa). Lane 2: Non-transfected lysate.

Quick Database Links

RefSeq (Protein):NP_000030.1